Web stats for Letsplayminecraftvideos - letsplayminecraftvideos.com
All you favourite Minecraft Videos Under One Roof!
1.67 Rating by ClearWebStats
letsplayminecraftvideos.com is 9 years 9 months 3 days old. This website has a #21,107,847 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. Additionally, the website is monetizing using Adsense. While no active threats were reported recently by users, letsplayminecraftvideos.com is SAFE to browse.
Traffic Report of Letsplayminecraftvideos
| Daily Unique Visitors: | 23 |
| Daily Pageviews: | 46 |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 21,107,847 |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
34
Siteadvisor Rating
Not Applicable
Where is letsplayminecraftvideos.com server located?
Hosted IP Address:
88.208.252.223
Hosted Country:
GB
Location Latitude:
51.4964Location Longitude:
-0.1224Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | 11 |
| H3 Headings: | 6 | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | 2 | Total Images: | 18 |
| Google Adsense: | pub-8079950109197396 | Google Analytics: | UA-18217863-25 |
Websites Hosted on Same IP (i.e. 88.208.252.223)
ACRE | Action with Communities in Rural England
Action with Communities in Rural England is the national voice for the community support agencies who make up the country’s largest rural network
4,236,315 
$ 240.00
Kieron Williamson
Here you will find everything you might need or want to know about Kieron and his incredible talent as one of the world’s youngest and most internationally
3,335,979 $ 240.00
AbleStable: Serving the Creative Community
The home page of AbleStable, an award winning web site dedicated to encourage and support creativity. AbleStable runs a listing of creative professionals, an on-line exhibitions area, a creative product area, and is an invaluable source of freeware, articles, and reviews for and about creative people.
4,484,822 $ 240.00
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 10 Aug 2016 21:33:09 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: close
X-UA-Compatible: IE=edge
Link:; rel=shortlink
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 10 Aug 2016 21:33:09 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: close
X-UA-Compatible: IE=edge
Link:
Domain Information for letsplayminecraftvideos.com
| Domain Registrar: |
TUCOWS DOMAINS INC.
|
|---|---|
| Registration Date: | 2014-07-27 9 years 9 months 3 days ago |
| Last Modified: | 2016-07-31 7 years 8 months 3 weeks ago |
| Expiration Date: | 2017-07-27 6 years 8 months 4 weeks ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.livedns.co.uk |
|
217.160.81.244 |
 Germany
|
| ns2.livedns.co.uk |
|
217.160.82.244 |
Germany
|
| ns3.livedns.co.uk |
|
185.132.35.244 |
Germany
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| letsplayminecraftvideos.com | A | 3579 |
IP:88.208.252.223 |
| letsplayminecraftvideos.com | NS | 3600 |
Target:ns2.livedns.co.uk |
| letsplayminecraftvideos.com | NS | 3600 |
Target:ns3.livedns.co.uk |
| letsplayminecraftvideos.com | NS | 3600 |
Target:ns1.livedns.co.uk |
| letsplayminecraftvideos.com | SOA | 3600 |
MNAME:ns1.livedns.co.uk RNAME:admin.letsplayminecraftvideos.com Serial:1418169416 Refresh:10800 Retry:3600 Expire:604800 |
| letsplayminecraftvideos.com | MX | 3600 |
Priority:10 Target:mailserver.letsplayminecraftvideos.com |
| letsplayminecraftvideos.com | TXT | 3600 |
TXT:google-site-verification=NjGdbhWQcQ_GvBV Fh7no_VktJuxwDyn47lNRHuL8D9E |
Similarly Ranked Websites to Letsplayminecraftvideos
RAWPRO - CANBERRA VIDEOGRAPHY
Canberra based Videography & Aerial photography
21,107,852 $ 8.95
Blue Ridge Pictures | 828-505-6312
Wedding Photography & Videography, Family Portraits, Seniors, Advertising, Studio, Fashion, Model, Product, Website, Food, Real Estate, Film Projects
21,107,873 $ 8.95
Oyun oyna, Flash oyunlar, yeni oyunlar, Oyun oyna, Flash oyunlar, yeni oyunlar, - En güncel flash oyun oynama siteniz!
21,107,886 $ 8.95
Full WHOIS Lookup for letsplayminecraftvideos.com
Whois Server Version 2.0
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: LETSPLAYMINECRAFTVIDEOS.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1.LIVEDNS.CO.UK
Name Server: NS2.LIVEDNS.CO.UK
Name Server: NS3.LIVEDNS.CO.UK
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Updated Date: 31-jul-2016
Creation Date: 27-jul-2014
Expiration Date: 27-jul-2017
>>> Last update of whois database: Wed, 10 Aug 2016 21:33:18 GMT
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: LETSPLAYMINECRAFTVIDEOS.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1.LIVEDNS.CO.UK
Name Server: NS2.LIVEDNS.CO.UK
Name Server: NS3.LIVEDNS.CO.UK
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Updated Date: 31-jul-2016
Creation Date: 27-jul-2014
Expiration Date: 27-jul-2017
>>> Last update of whois database: Wed, 10 Aug 2016 21:33:18 GMT